SCOPe 2.02: Domain d1n4xi_: 1n4x I:

Lineage for d1n4xi_ (1n4x I:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

8. Domain d1n4xi_: 1n4x I: [85325]
   Other proteins in same PDB: d1n4xl_, d1n4xm_
   part of scFv 1695
   complexed with cl

Details for d1n4xi_

PDB Entry: 1n4x, 1.7 Å

PDB Description: structure of scfv 1696 at acidic ph

PDB Compounds: (I:) immunoglobulin heavy chain variable region

SCOPe Domain Sequences for d1n4xi_:

Sequence; same for both SEQRES and ATOM records:

>d1n4xi_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvs

Timeline for d1n4xi_:

• d1n4xi_ first appeared in SCOP 1.65
  
• d1n4xi_ appears in SCOPe 2.01
  
• d1n4xi_ appears in SCOPe 2.03
  
• d1n4xi_ appears in the current release, SCOPe 2.08, called d1n4xi1