SCOP 1.75: Domain d1n4xh_: 1n4x H:

Lineage for d1n4xh_ (1n4x H:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity
   Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

8. Domain d1n4xh_: 1n4x H: [85324]
   Other proteins in same PDB: d1n4xl_, d1n4xm_
   part of scFv 1695

Details for d1n4xh_

PDB Entry: 1n4x, 1.7 Å

PDB Description: structure of scfv 1696 at acidic ph

PDB Compounds: (H:) immunoglobulin heavy chain variable region

SCOP Domain Sequences for d1n4xh_:

Sequence; same for both SEQRES and ATOM records:

>d1n4xh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvsa

Timeline for d1n4xh_:

• d1n4xh_ first appeared in SCOP 1.65
  
• d1n4xh_ appears in SCOP 1.73
  
• d1n4xh_ appears in SCOPe 2.01
  
• d1n4xh_ appears in the current release, SCOPe 2.08, called d1n4xh1