Lineage for d1n3nf_ (1n3n F:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1106406Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries)
    Uniprot P01887
  8. 1106626Domain d1n3nf_: 1n3n F: [85311]
    Other proteins in same PDB: d1n3na1, d1n3na2, d1n3nc1, d1n3nc2, d1n3ne1, d1n3ne2, d1n3ng1, d1n3ng2
    complexed with so4

Details for d1n3nf_

PDB Entry: 1n3n (more details), 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db
PDB Compounds: (F:) Beta-2-microglobulin

SCOPe Domain Sequences for d1n3nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3nf_ b.1.1.2 (F:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1n3nf_:

Click to download the PDB-style file with coordinates for d1n3nf_.
(The format of our PDB-style files is described here.)

Timeline for d1n3nf_: