Lineage for d1n3nf_ (1n3n F:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654119Protein beta2-microglobulin [88600] (4 species)
  7. 654353Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)
  8. 654473Domain d1n3nf_: 1n3n F: [85311]
    Other proteins in same PDB: d1n3na1, d1n3na2, d1n3nc1, d1n3nc2, d1n3ne1, d1n3ne2, d1n3ng1, d1n3ng2

Details for d1n3nf_

PDB Entry: 1n3n (more details), 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db
PDB Compounds: (F:) Beta-2-microglobulin

SCOP Domain Sequences for d1n3nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3nf_ b.1.1.2 (F:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1n3nf_:

Click to download the PDB-style file with coordinates for d1n3nf_.
(The format of our PDB-style files is described here.)

Timeline for d1n3nf_: