SCOPe 2.03: Domain d1n3ne2: 1n3n E:1-181

Lineage for d1n3ne2 (1n3n E:1-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries)

8. Domain d1n3ne2: 1n3n E:1-181 [85310]
   Other proteins in same PDB: d1n3na1, d1n3nb_, d1n3nc1, d1n3nd_, d1n3ne1, d1n3nf_, d1n3ng1, d1n3nh_
   complexed with so4

Details for d1n3ne2

PDB Entry: 1n3n, 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db

PDB Compounds: (E:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1n3ne2:

Sequence; same for both SEQRES and ATOM records:

>d1n3ne2 d.19.1.1 (E:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d1n3ne2:

• d1n3ne2 first appeared in SCOP 1.65
  
• d1n3ne2 appears in SCOPe 2.02
  
• d1n3ne2 appears in SCOPe 2.04
  
• d1n3ne2 appears in the current release, SCOPe 2.08