Lineage for d1n2ub_ (1n2u B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 333446Superfamily d.113.1: Nudix [55811] (2 families) (S)
  5. 333484Family d.113.1.2: Isopentenyl diphosphate isomerase [64369] (1 protein)
  6. 333485Protein Isopentenyl diphosphate isomerase [64370] (1 species)
  7. 333486Species Escherichia coli [TaxId:562] [64371] (6 PDB entries)
  8. 333495Domain d1n2ub_: 1n2u B: [85287]
    complexed with bhi, mg, mn; mutant

Details for d1n2ub_

PDB Entry: 1n2u (more details), 1.93 Å

PDB Description: Structure and Mechanism of Action of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: complex with the bromohydrine of IPP

SCOP Domain Sequences for d1n2ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2ub_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl

SCOP Domain Coordinates for d1n2ub_:

Click to download the PDB-style file with coordinates for d1n2ub_.
(The format of our PDB-style files is described here.)

Timeline for d1n2ub_:

  • d1n2ub_ is new in SCOP 1.65
  • d1n2ub_ became obsolete in SCOP 1.67