SCOP 1.71: Domain d1n1qa_: 1n1q A:

Lineage for d1n1qa_ (1n1q A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (7 proteins)

6. Protein Dodecameric ferritin homolog [47250] (10 species)

7. Species Bacillus brevis, Dps [TaxId:1393] [89026] (1 PDB entry)

8. Domain d1n1qa_: 1n1q A: [85260]

Details for d1n1qa_

PDB Entry: 1n1q, 2.2 Å

PDB Description: crystal structure of a dps protein from bacillus brevis

SCOP Domain Sequences for d1n1qa_:

Sequence; same for both SEQRES and ATOM records:

>d1n1qa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus brevis, Dps}
mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
addeatadmldaieaglekhvwmleafle

Timeline for d1n1qa_:

• d1n1qa_ first appeared in SCOP 1.65
  
• d1n1qa_ appears in SCOP 1.69
  
• d1n1qa_ appears in SCOP 1.73
  
• d1n1qa_ appears in the current release, SCOPe 2.08