Lineage for d1my0a_ (1my0 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403440Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 403441Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 403442Family c.94.1.1: Phosphate binding protein-like [53851] (26 proteins)
  6. 403555Protein Glutamate receptor ligand binding core [53881] (2 species)
  7. 403556Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (43 PDB entries)
  8. 403616Domain d1my0a_: 1my0 A: [85217]

Details for d1my0a_

PDB Entry: 1my0 (more details), 1.9 Å

PDB Description: crystal titration experiments (ampa co-crystals soaked in 100 nm brw)

SCOP Domain Sequences for d1my0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1my0a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOP Domain Coordinates for d1my0a_:

Click to download the PDB-style file with coordinates for d1my0a_.
(The format of our PDB-style files is described here.)

Timeline for d1my0a_: