![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Bacterial alpha-amylase [51447] (7 species) |
![]() | Species Archaeon Pyrococcus woesei [TaxId:2262] [89464] (3 PDB entries) |
![]() | Domain d1mxda2: 1mxd A:1-361 [85192] Other proteins in same PDB: d1mxda1 complexed with acr, act, ca, glc, zn |
PDB Entry: 1mxd (more details), 2 Å
SCOP Domain Sequences for d1mxda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mxda2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei} akyleleeggvimqafywdvpgggiwwdhirskipewyeagisaiwlpppskgmsggysm gydpydyfdlgeyyqkgtvetrfgskeelvrliqtahaygikviadvvinhraggdlewn pfvgdytwtdfskvasgkytanyldfhpnelhccdegtfggfpdichhkewdqywlwksn esyaaylrsigfdgwrfdyvkgygawvvrdwlnwwggwavgeywdtnvdallswayesga kvfdfplyykmdeafdnnnipalvyalqngqtvvsrdpfkavtfvanhdtdiiwnkypay afiltyegqpvifyrdfeewlnkdklinliwihdhlaggsttivyydndelifvrngdsr r
Timeline for d1mxda2: