Lineage for d1mwoa2 (1mwo A:1-361)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339388Protein Bacterial alpha-amylase [51447] (10 species)
  7. 1339432Species Pyrococcus woesei [TaxId:2262] [89464] (3 PDB entries)
  8. 1339435Domain d1mwoa2: 1mwo A:1-361 [85160]
    Other proteins in same PDB: d1mwoa1
    complexed with ca, zn

Details for d1mwoa2

PDB Entry: 1mwo (more details), 2.2 Å

PDB Description: Crystal Structure Analysis of the Hyperthermostable Pyrocoocus woesei alpha-amylase
PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d1mwoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwoa2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Pyrococcus woesei [TaxId: 2262]}
akyleleeggvimqafywdvpgggiwwdhirskipewyeagisaiwlpppskgmsggysm
gydpydyfdlgeyyqkgtvetrfgskeelvrliqtahaygikviadvvinhraggdlewn
pfvgdytwtdfskvasgkytanyldfhpnelhccdegtfggfpdichhkewdqywlwksn
esyaaylrsigfdgwrfdyvkgygawvvrdwlnwwggwavgeywdtnvdallswayesga
kvfdfplyykmdeafdnnnipalvyalqngqtvvsrdpfkavtfvanhdtdiiwnkypay
afiltyegqpvifyrdfeewlnkdklinliwihdhlaggsttivyydndelifvrngdsr
r

SCOPe Domain Coordinates for d1mwoa2:

Click to download the PDB-style file with coordinates for d1mwoa2.
(The format of our PDB-style files is described here.)

Timeline for d1mwoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwoa1