| Class b: All beta proteins [48724] (174 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Bacterial alpha-Amylase [51013] (9 species) |
| Species Pyrococcus woesei [TaxId:2262] [89383] (3 PDB entries) |
| Domain d1mwoa1: 1mwo A:362-434 [85159] Other proteins in same PDB: d1mwoa2 complexed with ca, zn |
PDB Entry: 1mwo (more details), 2.2 Å
SCOPe Domain Sequences for d1mwoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwoa1 b.71.1.1 (A:362-434) Bacterial alpha-Amylase {Pyrococcus woesei [TaxId: 2262]}
pglityinlspnwvgrwvyvpkfagaciheytgnlggwvdkrvdssgwvyleapphdpan
gyygysvwsycgv
Timeline for d1mwoa1: