SCOP 1.71: Domain d1mwoa1: 1mwo A:362-434

Lineage for d1mwoa1 (1mwo A:362-434)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (7 species)

7. Species Archaeon Pyrococcus woesei [TaxId:2262] [89383] (3 PDB entries)

8. Domain d1mwoa1: 1mwo A:362-434 [85159]
   Other proteins in same PDB: d1mwoa2
   complexed with ca, zn

Details for d1mwoa1

PDB Entry: 1mwo, 2.2 Å

PDB Description: Crystal Structure Analysis of the Hyperthermostable Pyrocoocus woesei alpha-amylase

SCOP Domain Sequences for d1mwoa1:

Sequence; same for both SEQRES and ATOM records:

>d1mwoa1 b.71.1.1 (A:362-434) Bacterial alpha-Amylase {Archaeon Pyrococcus woesei}
pglityinlspnwvgrwvyvpkfagaciheytgnlggwvdkrvdssgwvyleapphdpan
gyygysvwsycgv

Timeline for d1mwoa1:

• d1mwoa1 first appeared in SCOP 1.65
  
• d1mwoa1 appears in SCOP 1.69
  
• d1mwoa1 appears in SCOP 1.73
  
• d1mwoa1 appears in the current release, SCOPe 2.08