Lineage for d1mvfe_ (1mvf E:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813439Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 813440Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 813441Family b.129.1.1: Kis/PemI addiction antidote [89448] (1 protein)
    forms intertwined homodimer
  6. 813442Protein MazE [89449] (1 species)
  7. 813443Species Escherichia coli [TaxId:562] [89450] (2 PDB entries)
  8. 813445Domain d1mvfe_: 1mvf E: [85144]
    Other proteins in same PDB: d1mvfa_, d1mvfb_
    complex with camelid antibody VHh

Details for d1mvfe_

PDB Entry: 1mvf (more details), 1.65 Å

PDB Description: MazE addiction antidote
PDB Compounds: (E:) PemI-like protein 1

SCOP Domain Sequences for d1mvfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvfe_ b.129.1.1 (E:) MazE {Escherichia coli [TaxId: 562]}
ssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepv

SCOP Domain Coordinates for d1mvfe_:

Click to download the PDB-style file with coordinates for d1mvfe_.
(The format of our PDB-style files is described here.)

Timeline for d1mvfe_: