Class b: All beta proteins [48724] (176 folds) |
Fold b.129: Double-split beta-barrel [89446] (2 superfamilies) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) members of this superfamily are known or predicted to have DNA-binding function |
Family b.129.1.1: Kis/PemI addiction antidote [89448] (1 protein) forms intertwined homodimer |
Protein MazE [89449] (1 species) |
Species Escherichia coli [TaxId:562] [89450] (2 PDB entries) |
Domain d1mvfd_: 1mvf D: [85143] Other proteins in same PDB: d1mvfa_, d1mvfb_ complex with camelid antibody VHh |
PDB Entry: 1mvf (more details), 1.65 Å
SCOPe Domain Sequences for d1mvfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mvfd_ b.129.1.1 (D:) MazE {Escherichia coli [TaxId: 562]} ssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepv
Timeline for d1mvfd_: