Lineage for d1mvfd_ (1mvf D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569917Fold b.129: AbrB/MazE/MraZ-like [89446] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 569918Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 569919Family b.129.1.1: Kis/PemI addiction antidote [89448] (1 protein)
    forms intertwined homodimer
  6. 569920Protein MazE [89449] (1 species)
  7. 569921Species Escherichia coli [TaxId:562] [89450] (2 PDB entries)
  8. 569922Domain d1mvfd_: 1mvf D: [85143]
    Other proteins in same PDB: d1mvfa_, d1mvfb_

Details for d1mvfd_

PDB Entry: 1mvf (more details), 1.65 Å

PDB Description: MazE addiction antidote

SCOP Domain Sequences for d1mvfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvfd_ b.129.1.1 (D:) MazE {Escherichia coli}
ssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepv

SCOP Domain Coordinates for d1mvfd_:

Click to download the PDB-style file with coordinates for d1mvfd_.
(The format of our PDB-style files is described here.)

Timeline for d1mvfd_: