SCOPe 2.01: Domain d1mvfa_: 1mvf A:

Lineage for d1mvfa_ (1mvf A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
   SQ NA # camelid antibody

8. Domain d1mvfa_: 1mvf A: [85141]
   Other proteins in same PDB: d1mvfd_, d1mvfe_
   VHh against MazE addiction antidote

Details for d1mvfa_

PDB Entry: 1mvf, 1.65 Å

PDB Description: MazE addiction antidote

PDB Compounds: (A:) immunoglobulin heavy chain variable region

SCOPe Domain Sequences for d1mvfa_:

Sequence; same for both SEQRES and ATOM records:

>d1mvfa_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlscaasgftysrkymgwfrqapgkeregvaaifidngntiy
adsvqgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgt
qvtvssr

Timeline for d1mvfa_:

• d1mvfa_ first appeared in SCOP 1.65
  
• d1mvfa_ appears in SCOP 1.75
  
• d1mvfa_ appears in SCOPe 2.02
  
• d1mvfa_ appears in the current release, SCOPe 2.08