Lineage for d1muoa_ (1muo A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 611911Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 611912Species Human (Homo sapiens) [TaxId:9606] [90039] (5 PDB entries)
  8. 611917Domain d1muoa_: 1muo A: [85110]
    complexed with adn

Details for d1muoa_

PDB Entry: 1muo (more details), 2.9 Å

PDB Description: crystal structure of aurora-2, an oncogenic serine-threonine kinase

SCOP Domain Sequences for d1muoa_:

Sequence, based on SEQRES records: (download)

>d1muoa_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens)}
waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
hskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmhd
ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn
psqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records): (download)

>d1muoa_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens)}
waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
hskrvihrdikpenlllgsagelkiadfgwslcgtldylppemiegrmhdekvdlwslgv
lcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrev
lehpwitanss

SCOP Domain Coordinates for d1muoa_:

Click to download the PDB-style file with coordinates for d1muoa_.
(The format of our PDB-style files is described here.)

Timeline for d1muoa_: