Lineage for d1ms9b2 (1ms9 B:2-399)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 674917Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 674918Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 675061Protein Trypanosoma sialidase [82164] (2 species)
  7. 675062Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89371] (11 PDB entries)
  8. 675065Domain d1ms9b2: 1ms9 B:2-399 [85091]
    Other proteins in same PDB: d1ms9a1, d1ms9b1
    complexed with lat; mutant

Details for d1ms9b2

PDB Entry: 1ms9 (more details), 1.58 Å

PDB Description: Triclinic form of Trypanosoma cruzi trans-sialidase, in complex with lactose
PDB Compounds: (B:) Trans-sialidase

SCOP Domain Sequences for d1ms9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms9b2 b.68.1.1 (B:2-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]}
apgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdns
lidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsywt
shgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggagv
aivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkli
intrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvml
fthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheinsn
evyslvfarlvgelriiksvlqswknwdshlssictpa

SCOP Domain Coordinates for d1ms9b2:

Click to download the PDB-style file with coordinates for d1ms9b2.
(The format of our PDB-style files is described here.)

Timeline for d1ms9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ms9b1