Lineage for d1ms1b1 (1ms1 B:410-632)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556713Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 556714Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 556715Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89271] (11 PDB entries)
  8. 556724Domain d1ms1b1: 1ms1 B:410-632 [85066]
    Other proteins in same PDB: d1ms1a2, d1ms1b2
    complexed with dan, gol; mutant

Details for d1ms1b1

PDB Entry: 1ms1 (more details), 1.8 Å

PDB Description: monoclinic form of trypanosoma cruzi trans-sialidase, in complex with 3-deoxy-2,3-dehydro-n-acetylneuraminic acid (dana)

SCOP Domain Sequences for d1ms1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms1b1 b.29.1.15 (B:410-632) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi)}
cgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsqq
gqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiyg
stpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvggy
krsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteah

SCOP Domain Coordinates for d1ms1b1:

Click to download the PDB-style file with coordinates for d1ms1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ms1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ms1b2