SCOP 1.71: Domain d1mqkl_: 1mqk L:

Lineage for d1mqkl_ (1mqk L:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1mqkl_: 1mqk L: [85054]
   Other proteins in same PDB: d1mqkh_
   part of Fv against Paracoccus denitrificans cytochrome c oxidase

Details for d1mqkl_

PDB Entry: 1mqk, 1.28 Å

PDB Description: crystal structure of the unliganded fv-fragment of the anti-cytochrome c oxidase antibody 7e2

SCOP Domain Sequences for d1mqkl_:

Sequence; same for both SEQRES and ATOM records:

>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleikr

Timeline for d1mqkl_:

• d1mqkl_ first appeared in SCOP 1.65
  
• d1mqkl_ appears in SCOP 1.69
  
• d1mqkl_ appears in SCOP 1.73
  
• d1mqkl_ appears in the current release, SCOPe 2.08