Lineage for d1mqkh_ (1mqk H:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287992Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1287993Domain d1mqkh_: 1mqk H: [85053]
    Other proteins in same PDB: d1mqkl_
    part of Fv against Paracoccus denitrificans cytochrome c oxidase

Details for d1mqkh_

PDB Entry: 1mqk (more details), 1.28 Å

PDB Description: crystal structure of the unliganded fv-fragment of the anti-cytochrome c oxidase antibody 7e2
PDB Compounds: (H:) antibody 7E2 FV fragment, heavy chain

SCOPe Domain Sequences for d1mqkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssaw
rhp

SCOPe Domain Coordinates for d1mqkh_:

Click to download the PDB-style file with coordinates for d1mqkh_.
(The format of our PDB-style files is described here.)

Timeline for d1mqkh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mqkl_