SCOPe 2.06: Domain d1moeb2: 1moe B:120-240

Lineage for d1moeb2 (1moe B:120-240)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d1moeb2: 1moe B:120-240 [85033]
   Other proteins in same PDB: d1moea1, d1moeb1
   part of anti-CEA scFv T84.66; VL to VH linkage: linker residues 112-119; assembles as a diabody
   complexed with so4

Details for d1moeb2

PDB Entry: 1moe, 2.6 Å

PDB Description: the three-dimensional structure of an engineered scfv t84.66 dimer or diabody in vl to vh linkage.

PDB Compounds: (B:) anti-CEA mAb T84.66

SCOPe Domain Sequences for d1moeb2:

Sequence; same for both SEQRES and ATOM records:

>d1moeb2 b.1.1.1 (B:120-240) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnsky
vpkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvs
s

Timeline for d1moeb2:

• d1moeb2 first appeared in SCOP 1.65
  
• d1moeb2 appears in SCOPe 2.05
  
• d1moeb2 appears in SCOPe 2.07
  
• d1moeb2 appears in the current release, SCOPe 2.08