SCOP 1.65: Domain d1moea1: 1moe A:1-119

Lineage for d1moea1 (1moe A:1-119)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (23 PDB entries)

8. Domain d1moea1: 1moe A:1-119 [85030]
   Other proteins in same PDB: d1moea2, d1moeb2

Details for d1moea1

PDB Entry: 1moe, 2.6 Å

PDB Description: the three-dimensional structure of an engineered scfv t84.66 dimer or diabody in vl to vh linkage.

SCOP Domain Sequences for d1moea1:

Sequence; same for both SEQRES and ATOM records:

>d1moea1 b.1.1.1 (A:1-119) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2}
divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleikgggsgggg

Timeline for d1moea1:

• d1moea1 is new in SCOP 1.65
  
• d1moea1 appears in SCOP 1.67
  
• d1moea1 appears in the current release, SCOPe 2.08