SCOP 1.73: Domain d1mn3a_: 1mn3 A:

Lineage for d1mn3a_ (1mn3 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (4 families)

5. Family a.5.2.4: CUE domain [88995] (4 proteins)
   Pfam PF02845

6. Protein Vacuolar protein sorting-associated protein vps9 [88996] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88997] (2 PDB entries)

8. Domain d1mn3a_: 1mn3 A: [85024]
   part of the C-terminal helix-swapped homodimer
   complexed with mse; mutant

Details for d1mn3a_

PDB Entry: 1mn3, 2.3 Å

PDB Description: cue domain of yeast vps9p

PDB Compounds: (A:) Vacuolar protein sorting-associated protein VPS9

SCOP Domain Sequences for d1mn3a_:

Sequence; same for both SEQRES and ATOM records:

>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslikkieenerkdtlntlqnmfpdmdpsliedvciakksriepcvdallslse

Timeline for d1mn3a_:

• d1mn3a_ first appeared in SCOP 1.65
  
• d1mn3a_ appears in SCOP 1.71
  
• d1mn3a_ appears in SCOP 1.75
  
• d1mn3a_ appears in the current release, SCOPe 2.08