Lineage for d1mmfm_ (1mmf M:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699281Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
    automatically mapped to Pfam PF02287
  5. 2699282Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)
  6. 2699283Protein Diol dehydratase, gamma subunit [47150] (2 species)
  7. 2699301Species Klebsiella pneumoniae [TaxId:573] [81728] (2 PDB entries)
  8. 2699305Domain d1mmfm_: 1mmf M: [85023]
    Other proteins in same PDB: d1mmfa_, d1mmfb_, d1mmfe_, d1mmfl_
    complexed with b12, k

Details for d1mmfm_

PDB Entry: 1mmf (more details), 2.5 Å

PDB Description: Crystal structure of substrate free form of glycerol dehydratase
PDB Compounds: (M:) glycerol dehydrase gamma subunit

SCOPe Domain Sequences for d1mmfm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmfm_ a.23.2.1 (M:) Diol dehydratase, gamma subunit {Klebsiella pneumoniae [TaxId: 573]}
yplatrcpehiltptgkpltditlekvlsgevgpqdvrisrqtleyqaqiaeqmqrhava
rnfrraaeliaipderilaiynalrpfrssqaellaiadelehtwhatvnaafvresaev
yqqrhklrkgs

SCOPe Domain Coordinates for d1mmfm_:

Click to download the PDB-style file with coordinates for d1mmfm_.
(The format of our PDB-style files is described here.)

Timeline for d1mmfm_: