SCOPe 2.08: Domain d1ml3d1: 1ml3 D:1-164,D:334-359

Lineage for d1ml3d1 (1ml3 D:1-164,D:334-359)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)

7. Species Trypanosoma cruzi [TaxId:5693] [75104] (5 PDB entries)

8. Domain d1ml3d1: 1ml3 D:1-164,D:334-359 [85007]
   Other proteins in same PDB: d1ml3a2, d1ml3b2, d1ml3c2, d1ml3d2
   complexed with cyx, nad

Details for d1ml3d1

PDB Entry: 1ml3, 2.5 Å

PDB Description: Evidences for a flip-flop catalytic mechanism of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase, from its crystal structure in complex with reacted irreversible inhibitor 2-(2-phosphono-ethyl)-acrylic acid 4-nitro-phenyl ester

PDB Compounds: (D:) Glyceraldehyde 3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d1ml3d1:

Sequence; same for both SEQRES and ATOM records:

>d1ml3d1 c.2.1.3 (D:1-164,D:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

Timeline for d1ml3d1:

• d1ml3d1 first appeared in SCOP 1.65
  
• d1ml3d1 appears in SCOPe 2.07