Lineage for d1ml2a_ (1ml2 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773259Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 773260Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (123 PDB entries)
    Uniprot P00431
  8. 773293Domain d1ml2a_: 1ml2 A: [85000]
    complexed with zem; mutant

Details for d1ml2a_

PDB Entry: 1ml2 (more details), 1.65 Å

PDB Description: crystal structure of a mutant variant of cytochrome c peroxidase with zn(ii)-(20-oxo-protoporphyrin ix)
PDB Compounds: (A:) cytochrome c peroxidase

SCOP Domain Sequences for d1ml2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml2a_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawytsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1ml2a_:

Click to download the PDB-style file with coordinates for d1ml2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ml2a_: