Lineage for d1mkdg_ (1mkd G:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360609Fold a.125: PDEase [48546] (1 superfamily)
    multihelical; can be divided into three subdomains
  4. 360610Superfamily a.125.1: PDEase [48547] (1 family) (S)
  5. 360611Family a.125.1.1: PDEase [48548] (4 proteins)
    3',5'-cyclic-nucleotide phosphodiesterase, Pfam 00233
  6. 360616Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 360617Species Human (Homo sapiens) [TaxId:9606] [89152] (5 PDB entries)
  8. 360640Domain d1mkdg_: 1mkd G: [84988]

Details for d1mkdg_

PDB Entry: 1mkd (more details), 2.9 Å

PDB Description: crystal structure of PDE4D catalytic domain and zardaverine complex

SCOP Domain Sequences for d1mkdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkdg_ a.125.1.1 (G:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens)}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffpqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipqs

SCOP Domain Coordinates for d1mkdg_:

Click to download the PDB-style file with coordinates for d1mkdg_.
(The format of our PDB-style files is described here.)

Timeline for d1mkdg_: