Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Engineered (including hybrid species) [88562] (31 PDB entries) |
Domain d1mhpx_: 1mhp X: [84971] Other proteins in same PDB: d1mhpa_, d1mhpb_, d1mhph2, d1mhpl1, d1mhpl2, d1mhpy_ part of humanized anti-alpha1 integrin I-domain Fab; only V domain is ordered |
PDB Entry: 1mhp (more details), 2.8 Å
SCOP Domain Sequences for d1mhpx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhpx_ b.1.1.1 (X:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} evqlvesggglvqpggslrlscaasgftfsrytmswvrqapgkglewvatisggghtyyl dsvkgrftisrdnskntlylqmnslraedtavyyctrgfgdggyfdvwgqgtlvtvss
Timeline for d1mhpx_: