SCOPe 2.08: Domain d1mhpl1: 1mhp L:2-106

Lineage for d1mhpl1 (1mhp L:2-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (60 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d1mhpl1: 1mhp L:2-106 [84969]
   Other proteins in same PDB: d1mhpa_, d1mhpb_, d1mhph1, d1mhph2, d1mhpl2, d1mhpx_
   part of humanized anti-alpha1 integrin I-domain Fab
   complexed with mn

Details for d1mhpl1

PDB Entry: 1mhp, 2.8 Å

PDB Description: crystal structure of a chimeric alpha1 integrin i-domain in complex with the fab fragment of a humanized neutralizing antibody

PDB Compounds: (L:) Fab fragment, light chain

SCOPe Domain Sequences for d1mhpl1:

Sequence; same for both SEQRES and ATOM records:

>d1mhpl1 b.1.1.1 (L:2-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
iqltqspsslsasvgdrvtitcsasssvnhmfwyqqkpgkapkpwiyltsnlasgvpsrf
sgsgsgtdytltisslqpedfatyycqqwsgnpwtfgqgtkveik

Timeline for d1mhpl1:

• d1mhpl1 first appeared in SCOP 1.65
  
• d1mhpl1 appears in SCOPe 2.07