Lineage for d1mhph1 (1mhp H:1-118)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929502Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 929576Domain d1mhph1: 1mhp H:1-118 [84967]
    Other proteins in same PDB: d1mhpa_, d1mhpb_, d1mhph2, d1mhpl1, d1mhpl2, d1mhpy_
    part of humanized anti-alpha1 integrin I-domain Fab
    complexed with mn

Details for d1mhph1

PDB Entry: 1mhp (more details), 2.8 Å

PDB Description: crystal structure of a chimeric alpha1 integrin i-domain in complex with the fab fragment of a humanized neutralizing antibody
PDB Compounds: (H:) Fab fragment, heavy chain

SCOPe Domain Sequences for d1mhph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhph1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgftfsrytmswvrqapgkglewvatisggghtyyl
dsvkgrftisrdnskntlylqmnslraedtavyyctrgfgdggyfdvwgqgtlvtvss

SCOPe Domain Coordinates for d1mhph1:

Click to download the PDB-style file with coordinates for d1mhph1.
(The format of our PDB-style files is described here.)

Timeline for d1mhph1: