Lineage for d1mg8a_ (1mg8 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325382Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 325383Family d.15.1.1: Ubiquitin-related [54237] (8 proteins)
  6. 325434Protein Ubiquitin-like domain of parkin [89831] (2 species)
  7. 325437Species Mouse (Mus musculus) [TaxId:10090] [89833] (1 PDB entry)
  8. 325438Domain d1mg8a_: 1mg8 A: [84958]

Details for d1mg8a_

PDB Entry: 1mg8 (more details)

PDB Description: NMR structure of ubiquitin-like domain in murine Parkin

SCOP Domain Sequences for d1mg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg8a_ d.15.1.1 (A:) Ubiquitin-like domain of parkin {Mouse (Mus musculus)}
mgmivfvrfnssygfpvevdsdtsilqlkevvakrqgvpadqlrvifagkelpnhltvqn
cdleqqsivhivqrprrr

SCOP Domain Coordinates for d1mg8a_:

Click to download the PDB-style file with coordinates for d1mg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1mg8a_: