Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) common fold is elaborated with additional secondary structures |
Family d.58.26.6: Early switch protein XOL-1 [89953] (1 protein) lost the ATP-binding site |
Protein Early switch protein XOL-1 [89954] (1 species) primary determinant of sexual fate in C. elegans |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89955] (1 PDB entry) |
Domain d1mg7b2: 1mg7 B:188-380 [84957] Other proteins in same PDB: d1mg7a1, d1mg7b1 |
PDB Entry: 1mg7 (more details), 1.55 Å
SCOPe Domain Sequences for d1mg7b2:
Sequence, based on SEQRES records: (download)
>d1mg7b2 d.58.26.6 (B:188-380) Early switch protein XOL-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} eevhiiaedgslensngttehfnkkhdlvfvktdlhpedftpqmfpsqakakllrdafnn eededtfpdilvpaymtahsknrvrqedytclevefdsqvaleklmneheqvegfevqqg gilvalkkdsffddeliekiaiaiatesrqsvssvsfdllklgpgaslvtlansrrfepe crvvlqievkpvs
>d1mg7b2 d.58.26.6 (B:188-380) Early switch protein XOL-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} eevhiiaensngttehfnkkhdlvfvktdlhpedftpqmfpsqakakllrdafnneeded tfpdilvpaymtahsknrvrqedytclevefdsqvaleklmneheqvegfevqqggilva lkkdsffddeliekiaiaiatesrqsvssvsfdllklgpgaslvtlansrrfepecrvvl qievkpvs
Timeline for d1mg7b2: