Lineage for d1mg7a2 (1mg7 A:188-380)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654323Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1654379Family d.58.26.6: Early switch protein XOL-1 [89953] (1 protein)
    lost the ATP-binding site
    automatically mapped to Pfam PF09109
  6. 1654380Protein Early switch protein XOL-1 [89954] (1 species)
    primary determinant of sexual fate in C. elegans
  7. 1654381Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89955] (1 PDB entry)
  8. 1654382Domain d1mg7a2: 1mg7 A:188-380 [84955]
    Other proteins in same PDB: d1mg7a1, d1mg7b1

Details for d1mg7a2

PDB Entry: 1mg7 (more details), 1.55 Å

PDB Description: crystal structure of xol-1
PDB Compounds: (A:) early switch protein xol-1 2.2k splice form

SCOPe Domain Sequences for d1mg7a2:

Sequence, based on SEQRES records: (download)

>d1mg7a2 d.58.26.6 (A:188-380) Early switch protein XOL-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
eevhiiaedgslensngttehfnkkhdlvfvktdlhpedftpqmfpsqakakllrdafnn
eededtfpdilvpaymtahsknrvrqedytclevefdsqvaleklmneheqvegfevqqg
gilvalkkdsffddeliekiaiaiatesrqsvssvsfdllklgpgaslvtlansrrfepe
crvvlqievkpvs

Sequence, based on observed residues (ATOM records): (download)

>d1mg7a2 d.58.26.6 (A:188-380) Early switch protein XOL-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
eevhiiaesngttehfnkkhdlvfvktdlhpedftpqmfpsqakakllrdafnneededt
fpdilvpaymtahsknrvrqedytclevefdsqvaleklmneheqvegfevqqggilval
kkdsffddeliekiaiaiatesrqsvssvsfdllklgpgaslvtlansrrfepecrvvlq
ievkpvs

SCOPe Domain Coordinates for d1mg7a2:

Click to download the PDB-style file with coordinates for d1mg7a2.
(The format of our PDB-style files is described here.)

Timeline for d1mg7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mg7a1