SCOPe 2.02: Domain d1mg7a1: 1mg7 A:14-187

Lineage for d1mg7a1 (1mg7 A:14-187)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.6: Early switch protein XOL-1, N-terminal domain [89824] (1 protein)
   diverged from the GHMP Kinase family; lost the ATP-binding site

6. Protein Early switch protein XOL-1, N-terminal domain [89825] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89826] (1 PDB entry)

8. Domain d1mg7a1: 1mg7 A:14-187 [84954]
   Other proteins in same PDB: d1mg7a2, d1mg7b2

Details for d1mg7a1

PDB Entry: 1mg7, 1.55 Å

PDB Description: crystal structure of xol-1

PDB Compounds: (A:) early switch protein xol-1 2.2k splice form

SCOPe Domain Sequences for d1mg7a1:

Sequence, based on SEQRES records:

>d1mg7a1 d.14.1.6 (A:14-187) Early switch protein XOL-1, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
errvkilgidrsenspvltymeteddpnfrnsklaaaphtvhmmdsgflainrqclvkgk
ailarepkssnehmiddlpkhahdqhtlsilrdfidqlklhnvyeinfydpldssgklav
ipmlialwkcmlasetdicdqevlksimnsviakfelqipcknavidatlsgsr

Sequence, based on observed residues (ATOM records):

>d1mg7a1 d.14.1.6 (A:14-187) Early switch protein XOL-1, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
errvkilgidrsenspvltymsklaaaphtvhmmdsgflainrqclvkgkailarepkss
nehmiddlpkhahdqhtlsilrdfidqlklhnvyeinfydpldssgklavipmlialwkc
mlasetdicdqevlksimnsviakfelqipcknavidatlsgsr

Timeline for d1mg7a1:

• d1mg7a1 first appeared in SCOP 1.65
  
• d1mg7a1 appears in SCOPe 2.01
  
• d1mg7a1 appears in SCOPe 2.03
  
• d1mg7a1 appears in the current release, SCOPe 2.08