![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (9 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) |
![]() | Protein Calpain large subunit, catalytic domain (domain II) [54041] (3 species) includes the N-terminal 'sequence' domain I |
![]() | Species Rat (Rattus norvegicus), isozyme M [TaxId:10116] [54043] (2 PDB entries) |
![]() | Domain d1mdwb_: 1mdw B: [84935] calcium-bound protease core complexed with ca; mutant |
PDB Entry: 1mdw (more details), 1.95 Å
SCOP Domain Sequences for d1mdwb_:
Sequence, based on SEQRES records: (download)
>d1mdwb_ d.3.1.3 (B:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), isozyme M} raikylnqdyetlrnecleagalfqdpsfpalpsslgfkelgpyssktrgiewkrpteic adpqfiiggatrtdicqgalgdswllaaiasltlneeilarvvpldqsfqenyagifhfq fwqygewvevvvddrlptkdgellfvhsaegsefwsallekayakingcyealsggatte gfedftggiaewyelrkpppnlfkiiqkalekgsllgcsiditsaadseavtyqklvkgh aysvtgaeevessgslqklirirnpwgqvewtgkwndncpswntvdpevranlterqedg efwmsfsdflrhysrleicnltp
>d1mdwb_ d.3.1.3 (B:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), isozyme M} raikylnqdyetlrnecleagalfqdpsfpalpsslgfkelgpyssktrgiewkrpteic adpqfiiggatrtdicqgalgdswllaaiasltlneeilarvvpldqsfqenyagifhfq fwqygewvevvvddrlptkdgellfvhsaegsefwsallekayakingcyealsegfedf tggiaewyelrkpppnlfkiiqkalekgsllgcsiditsaadseavtyqklvkghaysvt gaeevessgslqklirirnpwgqvewtgkwndncpswntvdpevranlterqedgefwms fsdflrhysrleicnltp
Timeline for d1mdwb_: