Lineage for d1mdwa_ (1mdw A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498098Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 498099Superfamily d.3.1: Cysteine proteinases [54001] (11 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 498308Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
  6. 498309Protein Calpain large subunit, catalytic domain (domain II) [54041] (3 species)
    includes the N-terminal 'sequence' domain I
  7. 498313Species Rat (Rattus norvegicus), M-type [TaxId:10116] [54043] (2 PDB entries)
  8. 498314Domain d1mdwa_: 1mdw A: [84934]

Details for d1mdwa_

PDB Entry: 1mdw (more details), 1.95 Å

PDB Description: crystal structure of calcium-bound protease core of calpain ii reveals the basis for intrinsic inactivation

SCOP Domain Sequences for d1mdwa_:

Sequence, based on SEQRES records: (download)

>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type}
eraikylnqdyetlrnecleagalfqdpsfpalpsslgfkelgpyssktrgiewkrptei
cadpqfiiggatrtdicqgalgdswllaaiasltlneeilarvvpldqsfqenyagifhf
qfwqygewvevvvddrlptkdgellfvhsaegsefwsallekayakingcyealsggatt
egfedftggiaewyelrkpppnlfkiiqkalekgsllgcsiditsaadseavtyqklvkg
haysvtgaeevessgslqklirirnpwgqvewtgkwndncpswntvdpevranlterqed
gefwmsfsdflrhysrleicnlt

Sequence, based on observed residues (ATOM records): (download)

>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type}
eraikylnqdyetlrnecleagalfqdpsfpalpsslgfkelgpyssktrgiewkrptei
cadpqfiiggatrtdicqgalgdswllaaiasltlneeilarvvpldqsfqenyagifhf
qfwqygewvevvvddrlptkdgellfvhsaegsefwsallekayakingcyealsgegfe
dftggiaewyelrkpppnlfkiiqkalekgsllgcsiditsaadseavtyqklvkghays
vtgaeevessgslqklirirnpwgqvewtgkwndncpswntvdpevranlterqedgefw
msfsdflrhysrleicnlt

SCOP Domain Coordinates for d1mdwa_:

Click to download the PDB-style file with coordinates for d1mdwa_.
(The format of our PDB-style files is described here.)

Timeline for d1mdwa_: