SCOPe 2.01: Domain d1ma7a1: 1ma7 A:19-129

Lineage for d1ma7a1 (1ma7 A:19-129)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d1ma7a1: 1ma7 A:19-129 [84921]
   Other proteins in same PDB: d1ma7a2, d1ma7b2
   protein/DNA complex; mutant

Details for d1ma7a1

PDB Entry: 1ma7, 2.3 Å

PDB Description: Crystal structure of Cre site-specific recombinase complexed with a mutant DNA substrate, LoxP-A8/T27

PDB Compounds: (A:) cre recombinase

SCOPe Domain Sequences for d1ma7a1:

Sequence; same for both SEQRES and ATOM records:

>d1ma7a1 a.60.9.1 (A:19-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d1ma7a1:

• d1ma7a1 first appeared in SCOP 1.65
  
• d1ma7a1 appears in SCOP 1.75
  
• d1ma7a1 appears in SCOPe 2.02
  
• d1ma7a1 appears in the current release, SCOPe 2.08