SCOPe 2.05: Domain d1m9xh_: 1m9x H:

Lineage for d1m9xh_ (1m9x H:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (37 PDB entries)

8. Domain d1m9xh_: 1m9x H: [84912]
   Other proteins in same PDB: d1m9xa_, d1m9xb_, d1m9xe_, d1m9xf_

Details for d1m9xh_

PDB Entry: 1m9x, 1.7 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m,g89a complex.

PDB Compounds: (H:) hiv-1 capsid

SCOPe Domain Sequences for d1m9xh_:

Sequence; same for both SEQRES and ATOM records:

>d1m9xh_ a.73.1.1 (H:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvamapiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmys

Timeline for d1m9xh_:

• d1m9xh_ first appeared in SCOP 1.65
  
• d1m9xh_ appears in SCOPe 2.04
  
• d1m9xh_ appears in SCOPe 2.06
  
• d1m9xh_ appears in the current release, SCOPe 2.08