Lineage for d1m8ka1 (1m8k A:4-171)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860402Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2860460Species Methanobacterium thermoautotrophicum [TaxId:145262] [63975] (6 PDB entries)
  8. 2860466Domain d1m8ka1: 1m8k A:4-171 [84876]
    Other proteins in same PDB: d1m8ka2, d1m8kb2, d1m8kc2
    complexed with nad, so4; mutant

Details for d1m8ka1

PDB Entry: 1m8k (more details), 3 Å

PDB Description: crystal structure of methanobacterium thermoautotrophicum nicotinamide mononucleotide adenylyltransferase mutant h19a complexed with nad
PDB Compounds: (A:) Nicotinamide-nucleotide Adenylyltransferase

SCOPe Domain Sequences for d1m8ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ka1 c.26.1.3 (A:4-171) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mrgllvgrmqpfhrgalqviksileevdeliicigsaqlshsirdpftagervmmltkal
sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp
lfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhlak

SCOPe Domain Coordinates for d1m8ka1:

Click to download the PDB-style file with coordinates for d1m8ka1.
(The format of our PDB-style files is described here.)

Timeline for d1m8ka1: