Lineage for d1m7ib2 (1m7i B:114-213)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549566Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
  8. 549569Domain d1m7ib2: 1m7i B:114-213 [84868]
    Other proteins in same PDB: d1m7ia1, d1m7ia2, d1m7ib1
    part of Fab specific for Y lipopolysaccharide
    complexed with nag, raa, rao

Details for d1m7ib2

PDB Entry: 1m7i (more details), 2.5 Å

PDB Description: crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide complexed with a pentasaccharide

SCOP Domain Sequences for d1m7ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ib2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp

SCOP Domain Coordinates for d1m7ib2:

Click to download the PDB-style file with coordinates for d1m7ib2.
(The format of our PDB-style files is described here.)

Timeline for d1m7ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m7ib1