Lineage for d1m7ia1 (1m7i A:1-108)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287841Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)
  8. 287919Domain d1m7ia1: 1m7i A:1-108 [84865]
    Other proteins in same PDB: d1m7ia2, d1m7ib1, d1m7ib2
    part of Fab specific for Y lipopolysaccharide
    complexed with nag, raa, rao

Details for d1m7ia1

PDB Entry: 1m7i (more details), 2.5 Å

PDB Description: crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide complexed with a pentasaccharide

SCOP Domain Sequences for d1m7ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ia1 b.1.1.1 (A:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleikr

SCOP Domain Coordinates for d1m7ia1:

Click to download the PDB-style file with coordinates for d1m7ia1.
(The format of our PDB-style files is described here.)

Timeline for d1m7ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m7ia2