Lineage for d1m7db2 (1m7d B:114-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2359850Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
    Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region
  8. 2359853Domain d1m7db2: 1m7d B:114-213 [84864]
    Other proteins in same PDB: d1m7da1, d1m7da2, d1m7db1
    part of Fab specific for Y lipopolysaccharide
    complexed with mag, rae, ram

Details for d1m7db2

PDB Entry: 1m7d (more details), 2.3 Å

PDB Description: crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide complexed with a trisaccharide
PDB Compounds: (B:) heavy chain of the monoclonal antibody Fab SYA/J6

SCOPe Domain Sequences for d1m7db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7db2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp

SCOPe Domain Coordinates for d1m7db2:

Click to download the PDB-style file with coordinates for d1m7db2.
(The format of our PDB-style files is described here.)

Timeline for d1m7db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m7db1