SCOPe 2.04: Domain d1m7db2: 1m7d B:114-213

Lineage for d1m7db2 (1m7d B:114-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
   Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region

8. Domain d1m7db2: 1m7d B:114-213 [84864]
   Other proteins in same PDB: d1m7da1, d1m7da2, d1m7db1
   part of Fab specific for Y lipopolysaccharide

Details for d1m7db2

PDB Entry: 1m7d, 2.3 Å

PDB Description: crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide complexed with a trisaccharide

PDB Compounds: (B:) heavy chain of the monoclonal antibody Fab SYA/J6

SCOPe Domain Sequences for d1m7db2:

Sequence; same for both SEQRES and ATOM records:

>d1m7db2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp

Timeline for d1m7db2:

• d1m7db2 first appeared in SCOP 1.65
  
• d1m7db2 appears in SCOPe 2.03
  
• d1m7db2 appears in SCOPe 2.05
  
• d1m7db2 appears in the current release, SCOPe 2.08