Lineage for d1m7db1 (1m7d B:1-113)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103715Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (46 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1103749Domain d1m7db1: 1m7d B:1-113 [84863]
    Other proteins in same PDB: d1m7da1, d1m7da2, d1m7db2
    part of Fab specific for Y lipopolysaccharide

Details for d1m7db1

PDB Entry: 1m7d (more details), 2.3 Å

PDB Description: crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide complexed with a trisaccharide
PDB Compounds: (B:) heavy chain of the monoclonal antibody Fab SYA/J6

SCOPe Domain Sequences for d1m7db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7db1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkveesggglvqpggsmklscvasgftfsnywmewvrqspekglewvaeirlksnnyat
hyaesvkgrftisrddskssvylqmnnlraedtgiyyctrggavgamdywgqgtsvtvss

SCOPe Domain Coordinates for d1m7db1:

Click to download the PDB-style file with coordinates for d1m7db1.
(The format of our PDB-style files is described here.)

Timeline for d1m7db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m7db2