Lineage for d1m4ya_ (1m4y A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1044730Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1044825Species Thermotoga maritima [TaxId:2336] [90045] (1 PDB entry)
  8. 1044826Domain d1m4ya_: 1m4y A: [84802]
    complexed with na

Details for d1m4ya_

PDB Entry: 1m4y (more details), 2.1 Å

PDB Description: Crystal structure of HslV from Thermotoga maritima
PDB Compounds: (A:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1m4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]}
ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf
eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa
aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev

SCOPe Domain Coordinates for d1m4ya_:

Click to download the PDB-style file with coordinates for d1m4ya_.
(The format of our PDB-style files is described here.)

Timeline for d1m4ya_: