Lineage for d1m4ka1 (1m4k A:8-103)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290223Family b.1.1.4: I set domains [49159] (29 proteins)
  6. 290373Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 290386Species Human (Homo sapiens), kir2ds3, CD158j [TaxId:9606] [89190] (1 PDB entry)
  8. 290387Domain d1m4ka1: 1m4k A:8-103 [84796]

Details for d1m4ka1

PDB Entry: 1m4k (more details), 2.3 Å

PDB Description: Crystal structure of the human natural killer cell activator receptor KIR2DS2 (CD158j)

SCOP Domain Sequences for d1m4ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4ka1 b.1.1.4 (A:8-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2ds3, CD158j}
psllahpgplvkseetvilqcwsdvrfehfllhregkykdtlhligehhdgvskanfsig
pmmqdlagtyrcygsvthspyqlsapsdpldivitg

SCOP Domain Coordinates for d1m4ka1:

Click to download the PDB-style file with coordinates for d1m4ka1.
(The format of our PDB-style files is described here.)

Timeline for d1m4ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m4ka2