SCOP 1.65: Domain d1m35c2: 1m35 C:177-440

Lineage for d1m35c2 (1m35 C:177-440)

Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
duplication: composed of two very similar alpha+beta folds
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
Protein Aminopeptidase P, C-terminal domain [55928] (1 species)
Species Escherichia coli [TaxId:562] [55929] (4 PDB entries)
Domain d1m35c2: 1m35 C:177-440 [84775]
Other proteins in same PDB: d1m35a1, d1m35b1, d1m35c1, d1m35d1, d1m35e1, d1m35f1

Details for d1m35c2

PDB Entry: 1m35 (more details), 2.4 Å

PDB Description: Aminopeptidase P from Escherichia coli

SCOP Domain Sequences for d1m35c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m35c2 d.127.1.1 (C:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOP Domain Coordinates for d1m35c2:

Click to download the PDB-style file with coordinates for d1m35c2.
(The format of our PDB-style files is described here.)

Timeline for d1m35c2: