Lineage for d1m2pa_ (1m2p A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735376Protein Protein kinase CK2, alpha subunit [56142] (2 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 735382Species Maize (Zea mays) [TaxId:4577] [56143] (16 PDB entries)
  8. 735391Domain d1m2pa_: 1m2p A: [84758]
    complexed with hna

Details for d1m2pa_

PDB Entry: 1m2p (more details), 2 Å

PDB Description: Crystal structure of 1,8-di-hydroxy-4-nitro-anthraquinone/CK2 kinase complex
PDB Compounds: (A:) casein kinase II, alpha chain

SCOP Domain Sequences for d1m2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2pa_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraae

SCOP Domain Coordinates for d1m2pa_:

Click to download the PDB-style file with coordinates for d1m2pa_.
(The format of our PDB-style files is described here.)

Timeline for d1m2pa_: