SCOP 1.73: Domain d1ltxa2: 1ltx A:244-350

Lineage for d1ltxa2 (1ltx A:244-350)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.4: Rab geranylgeranyltransferase alpha-subunit, insert domain [49594] (1 family)

5. Family b.7.4.1: Rab geranylgeranyltransferase alpha-subunit, insert domain [49595] (1 protein)

6. Protein Rab geranylgeranyltransferase alpha-subunit, insert domain [49596] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49597] (2 PDB entries)

8. Domain d1ltxa2: 1ltx A:244-350 [84712]
   Other proteins in same PDB: d1ltxa1, d1ltxa3, d1ltxb_, d1ltxr1, d1ltxr2
   complexed with cl, far, zn2; mutant

Details for d1ltxa2

PDB Entry: 1ltx, 2.7 Å

PDB Description: structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid

PDB Compounds: (A:) rab geranylgeranyltransferase alpha subunit

SCOP Domain Sequences for d1ltxa2:

Sequence; same for both SEQRES and ATOM records:

>d1ltxa2 b.7.4.1 (A:244-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Rat (Rattus norvegicus) [TaxId: 10116]}
vlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvwlcd
lpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeq

Timeline for d1ltxa2:

• d1ltxa2 first appeared in SCOP 1.65
  
• d1ltxa2 appears in SCOP 1.71
  
• d1ltxa2 appears in SCOP 1.75
  
• d1ltxa2 appears in the current release, SCOPe 2.08